7NDP logo

7NDP

3D Structure View

Loading...

More Info

GENERAL
TITLE
X-RAY STRUCTURE OF ACETYLCHOLINE-BINDING PROTEIN (ACHBP) IN COMPLEX WITH FL001856.
DATE LAST MODIFIED
27 Apr 2022
RELEASE
7 Apr 2021
OBSOLETE
CLASSIFICATION
CHOLINE-BINDING PROTEIN
EXPERIMENT TYPE
X-RAY DIFFRACTION
SPACE GROUP
P 21 21 21
RESOLUTION RANGE HIGH
2
RESOLUTION RANGE LOW
47.53
PUBMED ID
DOI
10.1039/D0RA09844B
PDBe
--

Chains

Structure ChainTarget ProteinGeneExpression SystemOrganismSynonimsActions
P58154 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
Mutations
P58154 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
Mutations
P58154 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
Mutations
P58154 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
Mutations
P58154 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
Mutations
P58154 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
Mutations
P03612 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
P68400 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
P03612 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
P58154 -- SPODOPTERA FRUGIPERDA GREAT POND SNAIL
ACHBPMRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRP ...
Mutations
NGL Viewer is used for the molecular visualization.
  • AS Rose, AR Bradley, Y Valasatava, JM Duarte, A Prlić and PW Rose. NGL viewer: web-based molecular graphics for large complexes. Bioinformatics: bty419, 2018. doi:10.1093/bioinformatics/bty419
  • AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579 first published online April 29, 2015. doi:10.1093/nar/gkv402